Best and Coolest 18 Fraps


MTOR phosphorylated S2448 Mammalian Target of Rapamycin FRAP FRAP1 FRAP2 RAFT1 RAPT1 212115-50ug #ad

MTOR, phosphorylated (S2448) (Mammalian Target of Rapamycin, FRAP, FRAP1, FRAP2, RAFT1, RAPT1), 212115-50ug

MTOR, phosphorylated (S2448) (Mammalian Target of Rapamycin, FRAP, FRAP1, FRAP2, RAFT1, RAPT1), 212115-50ug #ad - Storage and stability may be stored at 4°c for short-term only. Recommended dilution western blot 1500-11000 immunohistochemistry 150-1100 immunofluorescence 150-1200 optimal dilutions to be determined by the researcher. Store at -20°c. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. This protein acts as the target for the cell-cycle arrest and immunosuppressive effects of the fkbp12-rapamycin complex. The protein encoded by this gene belongs to a family of phosphatidylinositol kinase-related kinases. Aliquot to avoid repeated freezing and thawing. The angptl7 gene is located in an intron of this gene. These kinases mediate cellular responses to stresses such as dna damage and nutrient deprivation. Other applications not tested. Applications suitable for use in immunofluorescence, western blot, immunohistochemistry.


Polyclonal Rabbit Anti-mTORFRAP 10 ul #ad

Polyclonal Rabbit Anti-mTOR/FRAP (10 ul)

Polyclonal Rabbit Anti-mTOR/FRAP (10 ul) #ad - Isotypes igg. Host species rabbit. Immunogen klh conjugated synthetic peptide derived from human mtor. Reactivities human,mouse,rat. Application ihc paraffin,if.


mTOR mTAb1 Mammalian Target of Rapamycin FRAP RAFT PE #ad

mTOR (mTAb1, Mammalian Target of Rapamycin, FRAP, RAFT) (PE)

mTOR (mTAb1, Mammalian Target of Rapamycin, FRAP, RAFT) (PE) #ad - Note applications are based on unconjugated antibody. The binding of frap to fkbp12-rapamycin correlated with the ability of these ligands to inhibit cell cycle progression. Freezing r-phycoerythrin (pe) conjugates will result in a substantial loss of activity. Dilute only prior to immediate use. The fkbp12-rapamycin complex is known to inhibit progression through the g1 cell cycle stage by interfering with mitogenic signaling pathways involved in g1 progression in several cell types, as well as in yeast. Stable for 12 months after receipt at 4°c. Mtor, or fkbp12 rapamycin associated protein (frap), is one of a family of proteins involved in cell cycle progression, dna recombination, and dna damage detection. May be stored at 4°c before opening. Do not freeze stable at 4°c as an undiluted liquid. Pe conjugates are sensitive to light. In rat, it is a 289kd protein (symbolized raft1) with significant homology to the saccharomyces cerevisiae protein tor1 and has been shown to associate with the immunophilin fkbp12 in a rapamycin dependent fashion.


FRAP m-PR #ad


FRAP (m)-PR #ad - Sirna products generally consist of pools of three to five target-specific 19-25 nt sirnas designed to knockdown gene expression for independent verification of mtor gene silencing results, individual sirna duplex components are also available upon request.


ELISA Kit for FK506 Binding Protein 12 Rapamycin Associated Protein FRAP #ad

ELISA Kit for FK506 Binding Protein 12 Rapamycin Associated Protein (FRAP)

ELISA Kit for FK506 Binding Protein 12 Rapamycin Associated Protein (FRAP) #ad - 25ng/ml, 0. 313ng/ml sensitivity the minimum detectable dose of this kit is typically less than 0. 5ng/ml, 1. 313-20ng/ml the standard curve concentrations used for the elisa’s were 20ng/ml, 10ng/ml, 5ng/ml, 2. 125ng/ml. This assay has high sensitivity and excellent specificity for detection of fk506 binding protein 12 rapamycin associated protein (frap)no significant cross-reactivity or interference between fk506 binding protein 12 rapamycin associated protein (frap) and analogues was observed. Detection range 0. 625ng/ml, 0.


mTOR mTAb1 Mammalian Target of Rapamycin FRAP RAFT HRP M4696-01D-HRP-100ul #ad

mTOR (mTAb1, Mammalian Target of Rapamycin, FRAP, RAFT) (HRP), M4696-01D-HRP-100ul

mTOR (mTAb1, Mammalian Target of Rapamycin, FRAP, RAFT) (HRP), M4696-01D-HRP-100ul #ad - Labeled with horseradish peroxidase (hrp). Aliquots are stable for 12 months after receipt. Mtor, or fkbp12 rapamycin associated protein (frap), is one of a family of proteins involved in cell cycle progression, dna recombination, and dna damage detection. In rat, it is a 289kd protein (symbolized raft1) with significant homology to the saccharomyces cerevisiae protein tor1 and has been shown to associate with the immunophilin fkbp12 in a rapamycin dependent fashion. The fkbp12-rapamycin complex is known to inhibit progression through the g1 cell cycle stage by interfering with mitogenic signaling pathways involved in g1 progression in several cell types, as well as in yeast. Aliquot to avoid repeated freezing and thawing. Note applications are based on unconjugated antibody. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. The binding of frap to fkbp12-rapamycin correlated with the ability of these ligands to inhibit cell cycle progression. May be stored at 4°c for short-term only. Store at -20°c. Sodium azide is a potent inhibitor of peroxidase and should not be added to hrp conjugates.


Rapamycin FRAP mTOR Inhibitor Sirolimus R1137-01-50mg #ad

Rapamycin (FRAP, mTOR Inhibitor, Sirolimus), R1137-01-50mg

Rapamycin (FRAP, mTOR Inhibitor, Sirolimus), R1137-01-50mg #ad - Further dilutions can be made in assay buffer. Aliquots are stable for at least 6 months at -20°c. For long-term storage, store at -20°c. Rapamycin also leads to the dephosphorylation of 4e-bp1/phas1, thereby promoting its binding to and inactivation of eif4e (4,5). Recommended dilution dilute into aqueous buffers to yield desired concentrations with final dmso concentrations of ~0. Other applications not tested. This activity has been shown to be the basis for rapamycin’s ability to block protein synthesis and to arrest cell cycle progression in the g1-phase (6,7). 1%. Rapamycin forms a complex with the immunophilin fkbp12 which then inhibits the activity of frap/mtor (tor in yeast) (2,3). Rapamycin is a bacterial macrolide with antifungal and immunosuppressant activities (1). For experiments with cultured cells, pretreat with 10nm of r1137-01 for one hour prior to stimulation. Such inhibitory activity is seen in cultured cells stimulated with fetal calf serum or a variety of growth factors. Ic50 values for inhibitory activity against frap/mtor are around 50pm. However, it has been suggested that rapamycin’s inhibition of the g1/s transition may be the consequence of its effect on cyclin d1 mrna and protein stability (8). Solubility soluble in dmso and methanol. Rapamycin treatment of cells leads to the dephosphorylation and inactivation of p70 s6 kinase. Melting point 173-187ºc storage and stability may be stored at 4°c for short-term only. Optimal dilutions to be determined by the researcher. Applications suitable for use in in vitro or cell based assays. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.


ELISA Kit for FK506 Binding Protein 12 Rapamycin Associated Protein FRAP ELISA Kit #ad

ELISA Kit for FK506 Binding Protein 12 Rapamycin Associated Protein (FRAP) (ELISA Kit)

ELISA Kit for FK506 Binding Protein 12 Rapamycin Associated Protein (FRAP) (ELISA Kit) #ad - Description principle of the assay the microtiter plate provided in this kit has been pre-coated with an antibody specific to frap. 313-20ng/ml the standard curve concentrations used for the elisa’s were 20ng/ml, 10ng/ml, 5ng/ml, 2. Of the samples to the standard curve. Standards or samples are then added to the appropriate microtiter plate wells with a biotin-conjugated antibody specific to frap. D. The standard, detection reagent a, detection reagent b and the 96-well strip plate should be stored at -20 degree c while others should be at 4 degree c. 313ng/ml storage for unopened kit, all the reagents should be kept according to the label on each vial. Next, avidin conjugated to horseradish peroxidase (hrp) is added to each microplate well and incubated. The enzyme-substrate reaction is terminated by the addition of sulphuric acid solution and the color change is measured spectrophotometrically at a wavelength of 450nm ± 10nm. 5ng/ml, 1. The concentration of frap in the samples is then determined by comparing the o. 625ng/ml, 0. 25ng/ml, 0. After tmb substrate solution is added, only those wells that contain frap, biotin-conjugated antibody and enzyme-conjugated avidin will exhibit a change in color. Detection range 0.


ATR CT SerineThreonine-protein Kinase ATR Ataxia Telangiectasia And Rad3-related Protein FRAP-related Protein 1 FRP1 APC A4020-01J-APC-200ul #ad

ATR, CT (Serine/Threonine-protein Kinase ATR, Ataxia Telangiectasia And Rad3-related Protein, FRAP-related Protein 1, FRP1) (APC), A4020-01J-APC-200ul

ATR, CT (Serine/Threonine-protein Kinase ATR, Ataxia Telangiectasia And Rad3-related Protein, FRAP-related Protein 1, FRP1) (APC), A4020-01J-APC-200ul #ad - Applications suitable for use in flisa and immunohistochemistry. Recommended dilution flisa 11,000 immunohistochemistry 150-1100 optimal dilutions to be determined by the researcher. Mutations of this gene are associated with seckel syndrome. Aliquot to avoid repeated freezing and thawing. Do not freeze apc conjugates. The protein encoded by this gene belongs the pi3/pi4-kinase family, and is most closely related to atm, a protein kinase encoded by the gene mutated in ataxia telangiectasia. This kinase has been shown to phosphorylate checkpoint kinase chk1, checkpoint proteins rad17, and rad9, as well as tumor suppressor protein brca1. Other applications not tested. Storage and stability may be stored at 4°c for short-term only. An alternatively spliced transcript variant of this gene has been reported, however, its full length nature is not known. Aliquots are stable for at least 6 months. Note applications are based on unconjugated antibody. This protein and atm share similarity with schizosaccharomyces pombe rad3, a cell cycle checkpoint gene required for cell cycle arrest and dna damage repair in response to dna damage. Light sensitive. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Transcript variants utilizing alternative polya sites exist.


Frap Strap™ #ad

Frap Strap™

Frap Strap™ #ad - All returns/exchanges will be given a return authorization number which is good for 25 days. Credit or replacement will not be issued for product misused or abused, or for incorrect sizes if the product has been worn. Frap strap® (604a) many therapeutic applications seams are melco taped instead of sewn to eliminate patient chaffing rubberized backing holds the frap strap in position washable one size fits all just trim to fit. Only items which are unused may be returned. Products not worn may be returned and subject to a 15% restocking charge. Once an item has been used a return can not be made . Return policy and guarantee products are guaranteed and will be replaced because of defect in material or workmanship. Returning products must have authorization number printed clearly on outside of returning mail package.


ATR CT SerineThreonine-protein Kinase ATR Ataxia Telangiectasia And Rad3-related Protein FRAP-related Protein 1 FRP1 A4020-01J-200ul #ad

ATR, CT (Serine/Threonine-protein Kinase ATR, Ataxia Telangiectasia And Rad3-related Protein, FRAP-related Protein 1, FRP1), A4020-01J-200ul

ATR, CT (Serine/Threonine-protein Kinase ATR, Ataxia Telangiectasia And Rad3-related Protein, FRAP-related Protein 1, FRP1), A4020-01J-200ul #ad - This kinase has been shown to phosphorylate checkpoint kinase chk1, checkpoint proteins rad17, and rad9, as well as tumor suppressor protein brca1. Storage and stability may be stored at 4°c for short-term only. Store at -20°c. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Applications suitable for use in elisa and immunohistochemistry. Aliquots are stable for at least 12 months. The protein encoded by this gene belongs the pi3/pi4-kinase family, and is most closely related to atm, a protein kinase encoded by the gene mutated in ataxia telangiectasia. Recommended dilution elisa 11,000 immunohistochemistry 150-1100 optimal dilutions to be determined by the researcher. An alternatively spliced transcript variant of this gene has been reported, however, its full length nature is not known. Aliquot to avoid repeated freezing and thawing. This protein and atm share similarity with schizosaccharomyces pombe rad3, a cell cycle checkpoint gene required for cell cycle arrest and dna damage repair in response to dna damage. Other applications not tested. Mutations of this gene are associated with seckel syndrome. Transcript variants utilizing alternative polya sites exist.


ATR CT SerineThreonine-protein Kinase ATR Ataxia Telangiectasia And Rad3-related Protein FRAP-related Protein 1 FRP1 Biotin A4020-01J-Biotin-200ul #ad

ATR, CT (Serine/Threonine-protein Kinase ATR, Ataxia Telangiectasia And Rad3-related Protein, FRAP-related Protein 1, FRP1) (Biotin), A4020-01J-Biotin-200ul

ATR, CT (Serine/Threonine-protein Kinase ATR, Ataxia Telangiectasia And Rad3-related Protein, FRAP-related Protein 1, FRP1) (Biotin), A4020-01J-Biotin-200ul #ad - Store at -20°c. This kinase has been shown to phosphorylate checkpoint kinase chk1, checkpoint proteins rad17, and rad9, as well as tumor suppressor protein brca1. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Aliquot to avoid repeated freezing and thawing. Storage and stability may be stored at 4°c for short-term only. Transcript variants utilizing alternative polya sites exist. Mutations of this gene are associated with seckel syndrome. Aliquots are stable for at least 6 months. The protein encoded by this gene belongs the pi3/pi4-kinase family, and is most closely related to atm, a protein kinase encoded by the gene mutated in ataxia telangiectasia. Applications suitable for use in elisa and immunohistochemistry. Recommended dilution elisa 11,000 immunohistochemistry 150-1100 optimal dilutions to be determined by the researcher. Note applications are based on unconjugated antibody. An alternatively spliced transcript variant of this gene has been reported, however, its full length nature is not known. This protein and atm share similarity with schizosaccharomyces pombe rad3, a cell cycle checkpoint gene required for cell cycle arrest and dna damage repair in response to dna damage. Other applications not tested.


MTOR Mammalian Target of Rapamycin FRAP FRAP1 FRAP2 RAFT1 RAPT1 212113-50ug #ad

MTOR (Mammalian Target of Rapamycin, FRAP, FRAP1, FRAP2, RAFT1, RAPT1), 212113-50ug

MTOR (Mammalian Target of Rapamycin, FRAP, FRAP1, FRAP2, RAFT1, RAPT1), 212113-50ug #ad - Other applications not tested. Applications suitable for use in immunofluorescence, western blot, immunohistochemistry. This protein acts as the target for the cell-cycle arrest and immunosuppressive effects of the fkbp12-rapamycin complex. Storage and stability may be stored at 4°c for short-term only. Recommended dilution western blot 1500-11000 immunohistochemistry 150-1100 immunofluorescence 150-1200 optimal dilutions to be determined by the researcher. Aliquots are stable for 12 months after receipt. The protein encoded by this gene belongs to a family of phosphatidylinositol kinase-related kinases. Aliquot to avoid repeated freezing and thawing. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. The angptl7 gene is located in an intron of this gene. Store at -20°c. These kinases mediate cellular responses to stresses such as dna damage and nutrient deprivation.


FRAP shRNA Plasmid m #ad

FRAP shRNA Plasmid (m)

FRAP shRNA Plasmid (m) #ad - Sirna products generally consist of pools of three to five target-specific 19-25 nt sirnas designed to knockdown gene expression for independent verification of mtor gene silencing results, individual sirna duplex components are also available upon request.


ATR CT SerineThreonine-protein Kinase ATR Ataxia Telangiectasia And Rad3-related Protein FRAP-related Protein 1 FRP1 FITC A4020-01J-FITC-200ul #ad

ATR, CT (Serine/Threonine-protein Kinase ATR, Ataxia Telangiectasia And Rad3-related Protein, FRAP-related Protein 1, FRP1) (FITC), A4020-01J-FITC-200ul

ATR, CT (Serine/Threonine-protein Kinase ATR, Ataxia Telangiectasia And Rad3-related Protein, FRAP-related Protein 1, FRP1) (FITC), A4020-01J-FITC-200ul #ad - Aliquots are stable for at least 6 months. Transcript variants utilizing alternative polya sites exist. Mutations of this gene are associated with seckel syndrome. The protein encoded by this gene belongs the pi3/pi4-kinase family, and is most closely related to atm, a protein kinase encoded by the gene mutated in ataxia telangiectasia. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note applications are based on unconjugated antibody. Light sensitive. Aliquot to avoid repeated freezing and thawing. This protein and atm share similarity with schizosaccharomyces pombe rad3, a cell cycle checkpoint gene required for cell cycle arrest and dna damage repair in response to dna damage. An alternatively spliced transcript variant of this gene has been reported, however, its full length nature is not known. Recommended dilution flisa 11,000 immunohistochemistry 150-1100 optimal dilutions to be determined by the researcher. Applications suitable for use in flisa and immunohistochemistry. Storage and stability may be stored at 4°c for short-term only. Other applications not tested. Do not freeze fitc conjugates. This kinase has been shown to phosphorylate checkpoint kinase chk1, checkpoint proteins rad17, and rad9, as well as tumor suppressor protein brca1.


mTOR mTAb1 Mammalian Target of Rapamycin FRAP RAFT AP M4696-01D-AP-100ul #ad

mTOR (mTAb1, Mammalian Target of Rapamycin, FRAP, RAFT) (AP), M4696-01D-AP-100ul

mTOR (mTAb1, Mammalian Target of Rapamycin, FRAP, RAFT) (AP), M4696-01D-AP-100ul #ad - Mtor, or fkbp12 rapamycin associated protein (frap), is one of a family of proteins involved in cell cycle progression, dna recombination, and dna damage detection. Further dilutions can be made in assay buffer. May be stored at 4°c before opening. Dilute only prior to immediate use. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note applications are based on unconjugated antibody. Do not freeze stable at 4°c as an undiluted liquid. Stable for 12 months after receipt. In rat, it is a 289kd protein (symbolized raft1) with significant homology to the saccharomyces cerevisiae protein tor1 and has been shown to associate with the immunophilin fkbp12 in a rapamycin dependent fashion. The binding of frap to fkbp12-rapamycin correlated with the ability of these ligands to inhibit cell cycle progression. The fkbp12-rapamycin complex is known to inhibit progression through the g1 cell cycle stage by interfering with mitogenic signaling pathways involved in g1 progression in several cell types, as well as in yeast. Freezing alkaline phosphatase conjugates will result in a substantial loss of activity.


mTOR NT Mammalian Target of Rapamycin Mechanistic Target of Rapamycin Serinethreonine Kinase FK506-binding Protein 12-rapamycin Complex-associated Protein 1 FKBP12-rapamycin Complex-associated Protein FRAP FRAP1 FRAP2 RAFT1 Rapamycin Target P #ad

mTOR, NT (Mammalian Target of Rapamycin, Mechanistic Target of Rapamycin (Serine/threonine Kinase), FK506-binding Protein 12-rapamycin Complex-associated Protein 1, FKBP12-rapamycin Complex-associated Protein, FRAP, FRAP1, FRAP2, RAFT1, Rapamycin Target P

mTOR, NT (Mammalian Target of Rapamycin, Mechanistic Target of Rapamycin (Serine/threonine Kinase), FK506-binding Protein 12-rapamycin Complex-associated Protein 1, FKBP12-rapamycin Complex-associated Protein, FRAP, FRAP1, FRAP2, RAFT1, Rapamycin Target P #ad - It acts as the target for the cell-cycle arrest and immunosuppressive effects of the fkbp12-rapamycin complex. Storage and stability may be stored at 4°c for short-term only. 1 channel mrna translation in dendrites. Other applications not tested. Recommended dilution western blot 1ug/ml immunohistochemistry (formalin fixed paraffin embedded) 5ug/ml optimal dilutions to be determined by the researcher. Store at -20°c. Aliquot to avoid repeated freezing and thawing. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. It is ubiquitously expressed in most of the tissues and is involved in suppression of kv1. Mtor, a t-cell binding protein is involved in the rapamycin pathway thus leading to progression of g1 phase of cell cycle and are known to mediate cellular responses to stresses like dna damage and nutrient deprivation. Applications suitable for use in western blot, immunohistochemistry and immunocytochemistry. It belongs to a family of phosphatidylinositol kinase-related kinases and possesses a pi3k catalytic domain and a fat domain. Aliquots are stable for at least 12 months. It controls the expression of ribosomal protein genes via fhl1.


ATR SerineThreonine-protein Kinase ATR Ataxia Telangiectasia And Rad3-related Protein FRAP-related Protein 1 FRP1 Biotin #ad

ATR (Serine/Threonine-protein Kinase ATR, Ataxia Telangiectasia And Rad3-related Protein, FRAP-related Protein 1, FRP1) (Biotin)

ATR (Serine/Threonine-protein Kinase ATR, Ataxia Telangiectasia And Rad3-related Protein, FRAP-related Protein 1, FRP1) (Biotin) #ad - Mutations of this gene are associated with seckel syndrome. Applications suitable for use in immunofluorescence, elisa and western blot. Transcript variants utilizing alternative polya sites exist. This kinase has been shown to phosphorylate checkpoint kinase chk1, checkpoint proteins rad17, and rad9, as well as tumor suppressor protein brca1. An alternatively spliced transcript variant of this gene has been reported, however, its full length nature is not known. Aa sequence dqreplmsvlktflhdplvewskpvkghskaplnetgevvnekakthvldieqrlqgviktrnrvtglplsieghvhyliqeatdenllcqmylgwtpym. This protein and atm share similarity with schizosaccharomyces pombe rad3, a cell cycle checkpoint gene required for cell cycle arrest and dna damage repair in response to dna damage. Other applications not tested. The protein encoded by this gene belongs the pi3/pi4-kinase family, and is most closely related to atm, a protein kinase encoded by the gene mutated in ataxia telangiectasia. Recommended dilution immunofluorescence 10ug/ml optimal dilutions to be determined by the researcher.

We are a participant in the Amazon Services LLC Associates Program, an affiliate advertising program designed to provide a means for us to earn fees by linking to and affiliated sites.