16 Greatest Lims


Dycem 50-1596LIM Non-Slip Circular Pad 7-12 Diameter Lime #ad

Dycem 50-1596LIM Non-Slip Circular Pad, 7-1/2″ Diameter, Lime

Dycem 50-1596LIM Non-Slip Circular Pad, 7-1/2″ Diameter, Lime #ad - Dycem placemats improve the stability of a variety of objects during therapy and around the home. The dycem 0. 4mm thick anti-slip mats and pads provide a secure surface that anchors items, such as a cup, plate, tool, note pad and telephone on the table or tray. This latex free material is reusable and easy to clean.


Lim - GeneMate 34 x 60 yards Specialty Labeling Tape #ad

Lim – GeneMate 3/4″ x 60 yards Specialty Labeling Tape

Lim – GeneMate 3/4″ x 60 yards Specialty Labeling Tape #ad - 60 yard rolls have a 3″ core. It can be written on with pen, pencil or permanent marker. The tape adheres to any dry surface and removes cleanly and easily. Specialty labeling tape is oil and acid resistant, waterproof and durable.




ECO-DENT TTHPOWDR,DLY CARE,LEM-LIM, 2 OZ #ad - 6-point pellets. Please keep the pallets in cold and dry place. Toothpowder daily care mint, lemon-lime, 2 oz by eco-dent (pack of 2). Gold is more effective for chronic pain while silver is more effective for acute pain.


FHL2 Four and a Half LIM Domains Protein 2 FHL-2 Protein Aging Associated Gene 11 AAG11 DRAL LIM Domain Protein DRAL Skeletal Muscle LIM Protein 3 SLIM3 APC #ad

FHL2 (Four and a Half LIM Domains Protein 2, FHL-2 Protein, Aging Associated Gene 11, AAG11, DRAL, LIM Domain Protein DRAL, Skeletal Muscle LIM Protein 3, SLIM3) APC

FHL2 (Four and a Half LIM Domains Protein 2, FHL-2 Protein, Aging Associated Gene 11, AAG11, DRAL, LIM Domain Protein DRAL, Skeletal Muscle LIM Protein 3, SLIM3) APC #ad - It negatively regulates the transcriptional repressor e4f1 and may function in cell growth. Recommended dilution immunofluorescence 10ug/ml optimal dilutions to be determined by the researcher. Applications suitable for use in immunofluorescence, elisa and western blot. Lim proteins contain a highly conserved double zinc finger motif called the lim domain. Fhl2 may function as a molecular transmitter linking various signaling pathways to transcriptional regulation. Other applications not tested. Aa sequence mterfdchhcneslfgkkyilreespycvvcfetlfantceecgkpigcdckdlsykdrhwheacfhcsqcrnslvdkpfaakedqllctdcysneysskcqeckktimpgtrkmeykgsswhetcfichrcqqpigtksfipkdnqnfcvpcyekqhamqcvqckkpittggvtyreqpwhkecfvctacrkqlsgqrftarddfayclncfcdlyakkcagctnpisglggtkyisfeerqwhndcfnckkcslslvgrgflterddilcpdcgkdi.


Lim - GeneMate 34 x 500 Specialty Labeling Tape #ad

Lim – GeneMate 3/4″ x 500″ Specialty Labeling Tape

Lim – GeneMate 3/4″ x 500″ Specialty Labeling Tape #ad - Specialty labeling tape is oil and acid resistant, waterproof and durable. The tape can withstand temperatures from -23°c to 121°c. Colors available are yellow, red, green, orange, blue, pink and white. 500″ rolls have a 1″ core. Tape adheres to any dry surface and removes cleanly and easily. It can be written on with pen, pencil or permanent marker.


LIM kinase 2 antibody - LIM domain kinase 2 100 μg supplied #ad

LIM kinase 2 antibody – LIM domain kinase 2, 100 μg supplied

LIM kinase 2 antibody – LIM domain kinase 2, 100 μg supplied #ad - The antibody solution should be gently mixed before use. Pak1 and rock phosphorylate limk1 and limk2, which increases the activity of the kinases. Stored at -20 °c for future use. Lim kinases (limk1 and limk2) are serine/threnine kinases that have two zinc finger motifs, known as lim motifs in their n-terminal regulatory domain. Rabbit polyclonal antibody to lim kinase 2. Activated lim kinases inhibit the actin depolymerization activity of cofilin by phosphorylation at the n-terminus of cofilin. Lim kinases are involved in actin cytoskeleton regulation through rho-family gtpases and downstream kinases paks and rock.


5 Boxes of Haeng Lim Tae Keuk Press Pellet Gold Color 6 150pcs #ad

5 Boxes of Haeng Lim Tae Keuk Press Pellet Gold Color #6 150pcs

5 Boxes of Haeng Lim Tae Keuk Press Pellet Gold Color #6 150pcs #ad - How to use clean the area before applying the pellet. Do not apply on an open wound. After placing the aluminum press, lightly press to apply the adhesive tape onto the skin. The aluminum pellet can be reused with fresh tape if desired.


Revco FTL6-LIM Lime Green Flame Resistant Cotton Long-sleeve T-Shirt Medium by Revco #ad

Revco FTL6-LIM Lime Green Flame Resistant Cotton Long-sleeve T-Shirt, Medium by Revco

Revco FTL6-LIM Lime Green Flame Resistant Cotton Long-sleeve T-Shirt, Medium by Revco #ad - Hrc 2 rated with an atpv value of 117 cal/cm2. Limited wash fr per astm 1506. Comfortable flame-resistant treated 9 oz cotton fabric.


Haeng Lim Smokeless Moxa Pipe #ad

Haeng Lim Smokeless Moxa Pipe

Haeng Lim Smokeless Moxa Pipe #ad - Pipe moxa. 200pcs per pack.


CTDSP2 NT CTDSP2 NIF2 OS4 SCP2 Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 2 Nuclear LIM interactor-interacting factor 2 Protein OS-4 Small C-terminal domain phosphatase 2 Small CTD phosphatase 2 Azide free HRP #ad

CTDSP2, NT (CTDSP2, NIF2, OS4, SCP2, Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 2, Nuclear LIM interactor-interacting factor 2, Protein OS-4, Small C-terminal domain phosphatase 2, Small CTD phosphatase 2) (Azide free) (HRP)

CTDSP2, NT (CTDSP2, NIF2, OS4, SCP2, Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 2, Nuclear LIM interactor-interacting factor 2, Protein OS-4, Small C-terminal domain phosphatase 2, Small CTD phosphatase 2) (Azide free) (HRP) #ad - May contribute to the development of sarcomas. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°c. Preferentially catalyzes the dephosphorylation of ‘ser-5′ within the tandem 7 residues repeats in the c-terminal domain (ctd) of the largest rna polymerase ii subunit polr2a. Applications suitable for use in western blot, elisa recommended dilution elisa 11,000 western blot 1100-500 storage and stability store product at 4°c if to be used immediately within two weeks. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Negatively regulates rna polymerase ii transcription, possibly by controlling the transition from initiation/capping to processive transcript elongation. Note applications are based on unconjugated antibody. Further dilutions can be made in assay buffer. Dilute required amount only prior to immediate use. Recruited by rest to neuronal genes that contain re-1 elements, leading to neuronal gene silencing in non-neuronal cells. Note sodium azide is a potent inhibitor of peroxidase and should not be added to hrp conjugates. Aliquots are stable at -20°c for 12 months after receipt.


Lim Electronics 8718M-04P-RO High Torque Stepper Motor 28amp #ad

Lim Electronics 8718M-04P-RO High Torque Stepper Motor 2.8amp

Lim Electronics 8718M-04P-RO High Torque Stepper Motor 2.8amp #ad - This item is used and in working condition. Comes in lime and measures 7-1/2 inch. Multi-purpose use. Non-slip surface. Reusable and easy to clean.




Proto T-CLT085 STAINLESS STEEL BAR CLAMP 10LB LIM #ad - Made of closed-cell foam. Measures 23″ x 72″ x 04″. Comes in lime. 0460196. Please read description before ordering please contact the seller if you have any questions.


Heang Lim Hand  Suji Injector #ad

Heang Lim Hand / Suji Injector

Heang Lim Hand / Suji Injector #ad - Measures 23″ x 72″ x 04″. 0460196. Made of closed-cell foam. Injector for hand needle. Please read description before ordering please contact the seller if you have any questions.


Airex 32-1247LIM Fitline Mat 180 Lime 23 x 72 x 04 #ad

Airex 32-1247LIM Fitline Mat 180, Lime, 23″ x 72″ x 0.4″

Airex 32-1247LIM Fitline Mat 180, Lime, 23″ x 72″ x 0.4″ #ad - Available either individually boxed or in case packaging. They are made from closed-cell foam with an “integrally molded skin” for extra toughness. Transverse ribbing pattern is molded into the mat to resist tearing and to give the mat enough flexibility to be “rolled-up” for carrying and storage. Airex mats are lightweight, comfortable and do not slide on the floor. Ideal for individual workouts and yet tough enough for use in fitness centers and therapy clinics.




CLEANWELL FOAM HAND WASH,SPRMNT LIM, 9.5 FZ, EA-1 #ad - Measures 23″ x 72″ x 04″. Made of closed-cell foam. Tear resistant. 0460196. Comes in lime.


Dycem 50-1501LIM Non-Slip Material Roll 8 x 6-12 Lime #ad

Dycem 50-1501LIM Non-Slip Material, Roll, 8″ x 6-1/2′, Lime

Dycem 50-1501LIM Non-Slip Material, Roll, 8″ x 6-1/2′, Lime #ad - Its flexibility allows it to easily form and fit around objects. This latex free material is reusable and easy to clean. 4mm thick and has a non-slip surface on both sides of the material. To use, simply cut the desired piece from the reel and place where needed. Material can be used for a variety of applications for gait re-education and balance activities can be used under hands, feet and knees to stabilize equipment or limbs in weight bearing exercises under plates for eating and dining beneath people’s feet and on seats to help improve positioning and posture when standing or sitting. Original dycem is 0.

We are a participant in the Amazon Services LLC Associates Program, an affiliate advertising program designed to provide a means for us to earn fees by linking to Amazon.com and affiliated sites.